PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G131900.1
Common NameB456_007G131900, LOC105803057
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 706aa    MW: 79626.6 Da    PI: 6.5075
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G131900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.11.5e-22145247199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f k+ltpsd++++g +++pk+++++       +++++ +++l+  d++g +W++++iyr++++r++lt+GW+ F  +++L +gD ++F   
  Gorai.007G131900.1 145 FSKKLTPSDTSTHGGFSIPKRHVDDGclppldMSQQTPQQELVAIDLHGFEWRFRHIYRGQPKRHLLTSGWSTFLTSKKLLAGDEFIFL-- 233
                         88*********************888*****9555555679************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++el+++++r+
  Gorai.007G131900.1 234 RGEKGELRLGIRRA 247
                         449999******97 PP

2Auxin_resp103.13.6e-34272354183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a ha+st+s+F+v Y+P++++seF++++++++k+ ++ +++G+Rf+m++e+e+++e+r sGt+++++d+d +rWpnS+Wr+Lk
  Gorai.007G131900.1 272 AFHAFSTRSMFNVNYRPWSTSSEFIISLDRYMKSAQIDYCIGTRFRMRLEGEECAEQRPSGTIISIEDVDHTRWPNSEWRCLK 354
                         679******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.22E-32137273IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-33143252IPR015300DNA-binding pseudobarrel domain
CDDcd100171.82E-18144246No hitNo description
PfamPF023621.6E-19145247IPR003340B3 DNA binding domain
PROSITE profilePS5086312.492145248IPR003340B3 DNA binding domain
SMARTSM010191.4E-17145248IPR003340B3 DNA binding domain
PfamPF065072.1E-30272354IPR010525Auxin response factor
PROSITE profilePS5174517.443603686IPR000270PB1 domain
SuperFamilySSF542777.85E-7603681No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 706 aa     Download sequence    Send to blast
MDGERNGLKA KVPFHPRRRI NVYGLPLLPP NNQGEKDDLH VELWHACAGP SVYVPRAGEK  60
VLYFPQGHIE QVDACMNQDG IMEMPIYNLP SKILCRVMHV QLKVEPGTDE VFAQITLIPE  120
AEQDEESLEH RNYQPLPQKA YPVFFSKKLT PSDTSTHGGF SIPKRHVDDG CLPPLDMSQQ  180
TPQQELVAID LHGFEWRFRH IYRGQPKRHL LTSGWSTFLT SKKLLAGDEF IFLRGEKGEL  240
RLGIRRATTV LKYTSTSIIS GHSMRHGILA SAFHAFSTRS MFNVNYRPWS TSSEFIISLD  300
RYMKSAQIDY CIGTRFRMRL EGEECAEQRP SGTIISIEDV DHTRWPNSEW RCLKVKWYPT  360
AGENFHPERV CPWNIEPTEF RIKKRPSILH NQKKARTDDV SSPGFSTLLM DGMWSGSIKY  420
ESQSSSGVLQ GQEDSDTDGN QPDALRQPLP HCLPLNHSWD SMQQPIQNQR EIGAAPFSGG  480
QVESLGLHNS WSTTFSSSNG VHEDAIASRK ISVPNVNSQE GSISEPRNEN ETSWCEPNEG  540
HACMLFGVNL VNGPLEPPSP QLVTSSELES HCSIPPTSQS TVSKPSKGTS SKQCDNCCSA  600
SNWSCTKVLK HGTALGRSVD ITRFDGYKDL ISELDRMFDF NGRLIDGSSG WHVTFTDDEG  660
EMRMIGDHYP WQKFQNEVRR MLINPKEEIG RVNQSSLMAP YDEVF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1293737717354Auxin response factor 1
4ldw_A1e-1293737717354Auxin response factor 1
4ldw_B1e-1293737717354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490461.10.0PREDICTED: auxin response factor 23-like isoform X1
TrEMBLA0A0D2P8950.0A0A0D2P895_G
STRINGVIT_07s0104g01230.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157971016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.21e-156auxin response factor 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]